Protein Info for Psyr_4529 in Pseudomonas syringae pv. syringae B728a

Annotation: LSU ribosomal protein L15P

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01071: ribosomal protein uL15
  • amino acids 2 to 142 (141 residues), 154 bits, E=1.2e-49
• PF00828: Ribosomal_L27A
  • amino acids 28 to 142 (115 residues), 105.2 bits, E=2e-34

Best Hits

Swiss-Prot: 100% identical to RL15_PSEU2: 50S ribosomal protein L15 (rplO) from Pseudomonas syringae pv. syringae (strain B728a)

KEGG orthology group: K02876, large subunit ribosomal protein L15 (inferred from 99% identity to pfl:PFL_5563)

MetaCyc: 66% identical to 50S ribosomal subunit protein L15 (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"LSU ribosomal protein L15p (L27Ae)" in subsystem Ribosome LSU bacterial

Sequence Analysis Tools

See Q4ZMR3 at UniProt or InterPro

Protein Sequence (144 amino acids)

>Psyr_4529 LSU ribosomal protein L15P (Pseudomonas syringae pv. syringae B728a)
MKLNDLSPAPGSRREKHRPGRGIGSGLGKTGGRGHKGQSSRSGGTIAPGFEGGQQPLHRR
LPKFGFVSLKAMDRAEVRLSELAKVEGDIVTVQSLKDANVINQNVQRVKIMLSGEVTRAV
TIKGIAATKGARAAIEAAGGKFEE