Protein Info for Psyr_4527 in Pseudomonas syringae pv. syringae B728a

Annotation: SSU ribosomal protein S13P

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 118 TIGR03631: ribosomal protein uS13" amino acids 3 to 114 (112 residues), 180.5 bits, see alignment E=5.7e-58 PF00416: Ribosomal_S13" amino acids 3 to 108 (106 residues), 112.9 bits, see alignment E=7.4e-37

Best Hits

Swiss-Prot: 100% identical to RS13_PSESM: 30S ribosomal protein S13 (rpsM) from Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)

KEGG orthology group: K02952, small subunit ribosomal protein S13 (inferred from 94% identity to pap:PSPA7_0859)

MetaCyc: 75% identical to 30S ribosomal subunit protein S13 (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"SSU ribosomal protein S13p (S18e)" in subsystem Ribosome SSU bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZMR5 at UniProt or InterPro

Protein Sequence (118 amino acids)

>Psyr_4527 SSU ribosomal protein S13P (Pseudomonas syringae pv. syringae B728a)
MARIAGVNIPDNKHTVISLTYIYGVGRTTAQKICATTGVNPAVKIKDLSDEQIEQLRGEV
AKFTTEGDLRREINMKIKRLMDLGCYRGLRHRRGLPVRGQRTKTNARTRKGPRKPIRK