Protein Info for Psyr_4518 in Pseudomonas syringae pv. syringae B728a

Annotation: single-strand binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00621: single-stranded DNA-binding protein
  • amino acids 2 to 183 (182 residues), 200.4 bits, E=1.2e-63
• PF00436: SSB
  • amino acids 5 to 107 (103 residues), 129 bits, E=3.3e-42

Best Hits

Swiss-Prot: 94% identical to SSB_PSESM: Single-stranded DNA-binding protein (ssb) from Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)

KEGG orthology group: K03111, single-strand DNA-binding protein (inferred from 100% identity to psb:Psyr_4518)

MetaCyc: 61% identical to ssDNA-binding protein (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Single-stranded DNA-binding protein" in subsystem DNA repair, bacterial or DNA repair, bacterial RecFOR pathway or pVir Plasmid of Campylobacter

Sequence Analysis Tools

See Q4ZMS4 at UniProt or InterPro

Protein Sequence (183 amino acids)

>Psyr_4518 single-strand binding protein (Pseudomonas syringae pv. syringae B728a)
MARGVNKVILVGTCGQDPEVRYLPNGNAVTNLSLATSEQWTDKQSGEKKEKTEWHRVSMF
GKVAEIAGEYLRKGSQVYIEGKLQTREWEKDGIKRYTTEIVVDMQGTMQLLGGRPQGDAQ
QGQGGGGNYNQSAPRPQQSRPQQSAPQQNYNQQQPQRDSRPAPPQQAPQPAADFDSFDDD
IPF