Protein Info for Psyr_4494 in Pseudomonas syringae pv. syringae B728a

Annotation: ABC-type phosphate/phosphonate transport system periplasmic component-like protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 283 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details PF12974: Phosphonate-bd" amino acids 44 to 248 (205 residues), 121.6 bits, see alignment E=5.8e-39 PF00497: SBP_bac_3" amino acids 50 to 240 (191 residues), 28.9 bits, see alignment E=1.2e-10 PF09084: NMT1" amino acids 57 to 229 (173 residues), 26.8 bits, see alignment E=6.9e-10

Best Hits

KEGG orthology group: None (inferred from 100% identity to psb:Psyr_4494)

Predicted SEED Role

"ABC-type phosphate/phosphonate transport system, periplasmic component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZMU8 at UniProt or InterPro

Protein Sequence (283 amino acids)

>Psyr_4494 ABC-type phosphate/phosphonate transport system periplasmic component-like protein (Pseudomonas syringae pv. syringae B728a)
MKLRLSCKAIMIALSVALSNVATSEELKVYNFSPVNQYNLNLSASFWNPIIKYVSEKSGV
NLTLKLGRTSSDTTSYVLAQEVDFAFTNHLFSPERDKMGWTVFGRRDAPALEGQIVVPVD
SPIHSLSELAGKEVVYPGPEAFIAYKVTSSELVKQGINTSTVFAGNMDGAFSQLLSGKAQ
AMGANSQLVSGYTEREGKSFRVLWSSASFNDLALMASPRVSKKERDAVANAFLNMQHDAD
GSRILREATELVHAPAPITFIPATEADYASYRDFYKSLPANLK