Protein Info for Psyr_4481 in Pseudomonas syringae pv. syringae B728a

Annotation: outer membrane transport energization protein ExbB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 230 transmembrane" amino acids 12 to 30 (19 residues), see Phobius details amino acids 117 to 143 (27 residues), see Phobius details amino acids 162 to 184 (23 residues), see Phobius details PF01618: MotA_ExbB" amino acids 93 to 197 (105 residues), 114.7 bits, see alignment E=1.2e-37

Best Hits

KEGG orthology group: K03561, biopolymer transport protein ExbB (inferred from 100% identity to psb:Psyr_4481)

Predicted SEED Role

"MotA/TolQ/ExbB proton channel family protein" in subsystem Ton and Tol transport systems

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZMW1 at UniProt or InterPro

Protein Sequence (230 amino acids)

>Psyr_4481 outer membrane transport energization protein ExbB (Pseudomonas syringae pv. syringae B728a)
MNTAYSVLITQSSMALLVIFSLVTWALLLGKTFQHWRLTRQNRRYATQFWAARDLKNALH
LPHSEGSLARLTDAGAQALAAPHDSPDLGHSWNRQDLLERSLRQQIHKERRRLESGMILL
ASIGSTAPFIGLFGTVFGIIHALSAISQAKSASIAVVAGPIGEALVATGVGIAVAVPAVL
AYNFFGRRLKLVIADLEEFAVDFLNLSQRNAFRLQPDHRDKTAPSLKGVS