Protein Info for Psyr_4479 in Pseudomonas syringae pv. syringae B728a

Annotation: 5-oxopent-3-ene-1,2,5-tricarboxylate decarboxylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01557: FAA_hydrolase
  • amino acids 72 to 275 (204 residues), 239.3 bits, E=1.9e-75

Best Hits

Swiss-Prot: 77% identical to UGL_BURM1: Ureidoglycolate lyase (Bmul_3283) from Burkholderia multivorans (strain ATCC 17616 / 249)

KEGG orthology group: None (inferred from 100% identity to psb:Psyr_4479)

MetaCyc: 78% identical to 2,4-didehydro-3-deoxy-L-fuconate hydrolase (Burkholderia multivorans)
RXN-12096 [EC: 3.7.1.26]

Predicted SEED Role

"5-oxopent-3-ene-1,2,5-tricarboxylate decarboxylase." in subsystem Aromatic amino acid degradation

MetaCyc Pathways

• L-arabinose degradation V (4/6 steps found)
• L-rhamnose degradation III (3/7 steps found)
• L-fucose degradation III (3/8 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.7.1.26

Sequence Analysis Tools

See Q4ZMW3 at UniProt or InterPro

Protein Sequence (282 amino acids)

>Psyr_4479 5-oxopent-3-ene-1,2,5-tricarboxylate decarboxylase (Pseudomonas syringae pv. syringae B728a)
MKLLRYGEKGLEKPGVLDAANQIRDLSAHVKDIAGDVLSPAGLASLAALDPESLPLVPGQ
PRIGPCVGQVGKFICIGLNYADHAAESQMEVPKEPIIFNKWTSAICGPNDDVQIPRGSLK
TDWEVELGVIIGKGGRYIDEADAMEHVAGYCVINDVSEREWQLERGGTWDKGKGFDTFGP
LGPWLVTRDEVADPHSLDLWLEVDGHRYQNGNTRTLIFSVPQLIAYLSRCMSLQPGDVIS
TGTPPGVGQGVKPQPVFLRAGQRIRLGIAGLGEQNQLTVQAD