Protein Info for Psyr_4463 in Pseudomonas syringae pv. syringae B728a

Annotation: Protein of unknown function DUF193

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 165 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details TIGR00244: transcriptional regulator NrdR" amino acids 12 to 158 (147 residues), 234.3 bits, see alignment E=2.5e-74 PF22811: Zn_ribbon_NrdR" amino acids 12 to 53 (42 residues), 79.1 bits, see alignment E=1.8e-26 PF03477: ATP-cone" amino acids 63 to 147 (85 residues), 68.5 bits, see alignment E=6e-23

Best Hits

Swiss-Prot: 100% identical to NRDR_PSEU2: Transcriptional repressor NrdR (nrdR) from Pseudomonas syringae pv. syringae (strain B728a)

KEGG orthology group: K07738, transcriptional repressor NrdR (inferred from 97% identity to pfo:Pfl01_5020)

Predicted SEED Role

"Ribonucleotide reductase transcriptional regulator NrdR" in subsystem Ribonucleotide reduction

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZMX9 at UniProt or InterPro

Protein Sequence (165 amino acids)

>Psyr_4463 Protein of unknown function DUF193 (Pseudomonas syringae pv. syringae B728a)
MALLILLLPATMHCPFCGANDTKVIDSRLVAEGEQVRRRRECLACGERFTTFETAELVLP
RLIKQDGSRQPFDEEKLRAGMQRALEKRPVSVERLEAALVHIKHKLRATGEREVKSLVVG
ELVMTELQKLDEVAYIRFASVYRRFQDLNEFREEIDRLAREPGKE