Protein Info for Psyr_4451 in Pseudomonas syringae pv. syringae B728a

Annotation: UreE urease accessory, N-terminal:UreE urease accessory, C-terminal

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02814: UreE_N
  • amino acids 9 to 65 (57 residues), 61 bits, E=6.3e-21
• PF05194: UreE_C
  • amino acids 72 to 146 (75 residues), 98.2 bits, E=2.7e-32

Best Hits

Swiss-Prot: 100% identical to UREE2_PSEU2: Urease accessory protein UreE 2 (ureE2) from Pseudomonas syringae pv. syringae (strain B728a)

KEGG orthology group: K03187, urease accessory protein (inferred from 100% identity to psb:Psyr_4451)

Predicted SEED Role

"Urease accessory protein UreE" in subsystem Urea decomposition

MetaCyc Pathways

• urea degradation II (1/1 steps found)
• superpathway of allantoin degradation in plants (4/8 steps found)

Sequence Analysis Tools

See Q4ZMZ1 at UniProt or InterPro

Protein Sequence (166 amino acids)

>Psyr_4451 UreE urease accessory, N-terminal:UreE urease accessory, C-terminal (Pseudomonas syringae pv. syringae B728a)
MLVIHDRIEPQAEWAAELHLNFEARSKSRLRCFSAENEDVGLFLQRGQSPLRDGEFLQAQ
DGRVVRVCARPEKLMHVTCSSTFELTRAAYHLGNRHVALQVGDGWLRLLDDYVLKAMLDQ
LGATVETIEAPFQPEHGAYGGGHHHSRAGEEDFNYPPRMHQFGVRK