Protein Info for Psyr_4442 in Pseudomonas syringae pv. syringae B728a

Annotation: membrane protein, putative

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 336 transmembrane" amino acids 12 to 40 (29 residues), see Phobius details amino acids 61 to 87 (27 residues), see Phobius details amino acids 148 to 167 (20 residues), see Phobius details amino acids 202 to 227 (26 residues), see Phobius details amino acids 229 to 249 (21 residues), see Phobius details amino acids 254 to 277 (24 residues), see Phobius details amino acids 300 to 325 (26 residues), see Phobius details

Best Hits

KEGG orthology group: None (inferred from 99% identity to psp:PSPPH_4485)

Predicted SEED Role

"membrane protein, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZN00 at UniProt or InterPro

Protein Sequence (336 amino acids)

>Psyr_4442 membrane protein, putative (Pseudomonas syringae pv. syringae B728a)
MPTFSARQVLIASWILVFGGLLLVLPFKLLPSLLAGLLVFELVNMLTPKLQRLISGERAR
WLAVALLGTLVVSLLTLIFAGAISFVLHEAENPGASLDKFMTLVDRARGQLPPFIDAYLP
ASAAEFQVSLGQWLQKHVGELQLIGKGAAHMFVTMLIGMVLGAIIALQRISDVHARKPLA
AALFDRLYLVSRAFRNIVFAQIKISLLNTAFTSVFLAVVLPLCGIHLPLTKTLIIMTFLL
GLLPVVGNLMSNTLIFIVGMSISIWVALAALGYLIVIHKVEYFLNARIVGGQINAKSWEL
LLAMLLFEAAFGLPGVVAGPIYYAYLKSELQKEGLV