Protein Info for Psyr_4434 in Pseudomonas syringae pv. syringae B728a

Annotation: GCN5-related N-acetyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 177 PF13673: Acetyltransf_10" amino acids 51 to 150 (100 residues), 43.6 bits, see alignment E=5.7e-15 PF00583: Acetyltransf_1" amino acids 57 to 141 (85 residues), 44.1 bits, see alignment E=4.7e-15 PF13508: Acetyltransf_7" amino acids 64 to 144 (81 residues), 43.3 bits, see alignment E=8.2e-15 PF08445: FR47" amino acids 91 to 148 (58 residues), 22.8 bits, see alignment E=1.5e-08

Best Hits

Swiss-Prot: 92% identical to TTR_PSEAJ: Acetyltransferase (ttr) from Pseudomonas amygdali pv. tabaci

KEGG orthology group: None (inferred from 100% identity to psb:Psyr_4434)

MetaCyc: 92% identical to tabtoxinine-beta-lactam acetyltransferase (Pseudomonas syringae)
2.3.1.-

Predicted SEED Role

"Tabtoxin resistance protein"

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZN08 at UniProt or InterPro

Protein Sequence (177 amino acids)

>Psyr_4434 GCN5-related N-acetyltransferase (Pseudomonas syringae pv. syringae B728a)
MNHAQLRRVTAESFAHYRHGLAQLLFDTVHGGASVGFMADLDMQQAYAWCDSLKADITAG
DLLLWVVAEDSHVLASAQLSLCQKPNGLNRAEVQKLMVLPQARGRGLGRQLMEEVEQTAV
KHKRGLLHLDTEAGSTAEAFYSALAYNRVGELPDYCATPDGRYRPTAIYFKTLGQPT