Protein Info for Psyr_4427 in Pseudomonas syringae pv. syringae B728a

Annotation: amino acid/amide ABC transporter membrane protein 1, HAAT family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 529 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details transmembrane" amino acids 241 to 264 (24 residues), see Phobius details amino acids 271 to 290 (20 residues), see Phobius details amino acids 296 to 316 (21 residues), see Phobius details amino acids 329 to 350 (22 residues), see Phobius details amino acids 378 to 397 (20 residues), see Phobius details amino acids 430 to 449 (20 residues), see Phobius details amino acids 462 to 487 (26 residues), see Phobius details amino acids 495 to 514 (20 residues), see Phobius details TIGR03409: urea ABC transporter, permease protein UrtB" amino acids 235 to 526 (292 residues), 438.9 bits, see alignment E=5.6e-136 PF02653: BPD_transp_2" amino acids 238 to 512 (275 residues), 148.6 bits, see alignment E=9.8e-48

Best Hits

KEGG orthology group: K01997, branched-chain amino acid transport system permease protein (inferred from 100% identity to psb:Psyr_4427)

Predicted SEED Role

"Urea ABC transporter, permease protein UrtB" in subsystem Urea decomposition

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZN15 at UniProt or InterPro

Protein Sequence (529 amino acids)

>Psyr_4427 amino acid/amide ABC transporter membrane protein 1, HAAT family (Pseudomonas syringae pv. syringae B728a)
MPSYFYRLILAICLLLPLAAQAGDASDFVAASSSQQAELLEAWAAKPVPERVELLEALRD
GRVGADSSKRAWIENNDQYVAVDAQAPAAADAPTPDEPRKLRLNNRLRGLVETALASHQL
LAADTRLRMAAALQLQKSARPAQLELLTERVAGETDSSVKSALTLALANLQMVDSSPTVR
LAAVRLLGETGDPLARTRLESLLAPGVETDASVRVAAETSLAQVKRKLMIGEILGQAFSG
MSLGSILLLAALGLAITFGLLGVINMAHGEMLMLGAYSTYVVQLMLQRYAPGAIEYYPLI
ALPVAFFVTAAIGMALERTVIRHLYGRPLETLLATWGISLMLIQAVRLAFGAQNVEVANP
QWLSGGIQVLPNLVLPYNRIVIIAFALFVVVLTWLLLNKTRLGLNVRAVTQNRNMAACCG
VPTGRIDMMAFGLGSGIAGLGGVALSQIGNVGPDLGQSYIIDSFLVVVLGGVGQLAGSVM
AAFGLGIANKILEPQIGAVLGKILILALIILFIQKRPQGLFALKGRVID