Protein Info for Psyr_4426 in Pseudomonas syringae pv. syringae B728a

Annotation: amino acid/amide ABC transporter substrate-binding protein, HAAT family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 421 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details PF13458: Peripla_BP_6" amino acids 30 to 387 (358 residues), 250.8 bits, see alignment E=3.2e-78 PF13433: Peripla_BP_5" amino acids 31 to 407 (377 residues), 557.9 bits, see alignment E=1.1e-171 TIGR03407: urea ABC transporter, urea binding protein" amino acids 31 to 404 (374 residues), 605.1 bits, see alignment E=2e-186

Best Hits

KEGG orthology group: K01999, branched-chain amino acid transport system substrate-binding protein (inferred from 100% identity to psb:Psyr_4426)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZN16 at UniProt or InterPro

Protein Sequence (421 amino acids)

>Psyr_4426 amino acid/amide ABC transporter substrate-binding protein, HAAT family (Pseudomonas syringae pv. syringae B728a)
MKRRSLIKAFTLSASIAAMGLTWTVQAAETIKVGILHSLSGTMAISETSLKDMALMTIDE
INAKGGVNGKMLEPVVVDPASNWPLFAEKGRQLLTQDKVAVVFGCWTSVSRKSVLPVFEE
LNGLLFYPVQYEGEEMSPNVFYTGAAPNQQAIPAVDYVMSEDGGAAKRFFLLGTDYVYPR
TTNKILRAFLHSKGVKDTDIEEVYTPFGHSDYQTIVANIKKFSAGGKTAVISTVNGDSNV
PFYKELANQGLNATDVPVVAFSVGEEELRGIDTKPLVGHLAAWNYFQSVENPVNKKFVAD
WKAYAKKKNLPGADKAVTNDPMEATYVGIHMWAQAVEKAKSTDVDKVREAMAGQTFAAPS
GFTLTMDKTNHHLHKPVMIGEIQDDGQFNVVWQTKEPIRAQPWSPYIPGNDKKPDAPAKS
N