Protein Info for Psyr_4419 in Pseudomonas syringae pv. syringae B728a

Annotation: Cobalamin (vitamin B12) biosynthesis CbiD protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 370 PF01888: CbiD" amino acids 12 to 271 (260 residues), 302.5 bits, see alignment E=1.1e-94 TIGR00312: cobalamin biosynthesis protein CbiD" amino acids 19 to 316 (298 residues), 206.8 bits, see alignment E=2e-65

Best Hits

Swiss-Prot: 100% identical to CBID_PSEU2: Cobalt-precorrin-5B C(1)-methyltransferase (cbiD) from Pseudomonas syringae pv. syringae (strain B728a)

KEGG orthology group: K02188, cobalamin biosynthesis protein CbiD (inferred from 100% identity to psb:Psyr_4419)

Predicted SEED Role

"Cobalt-precorrin-6 synthase, anaerobic" in subsystem Cobalamin synthesis or Coenzyme B12 biosynthesis

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZN23 at UniProt or InterPro

Protein Sequence (370 amino acids)

>Psyr_4419 Cobalamin (vitamin B12) biosynthesis CbiD protein (Pseudomonas syringae pv. syringae B728a)
MREETAEQPAPLRSGLTTGSCATATSLAAARLLLCGQVSDAVEIVLPKGKQVQMRLEFCR
LVDNFAEAATLKDAGDDPDVTHGALVFARVRLQAAAGVRFLAGAGVGTVTRPGLVLAVGE
PAINPVPRRMMTEHLLQLAEEQGYSGGFEVTIGVEGGEALALKTMNPRLGILGGLSILGT
SGIVRPFSCAAYIASIHQGIDVATTNGYRHIAACTGNASEDTMRRVYKIPDIALIEMGDF
VGAVLKHLRRVSVDKLSVCGGFGKISKLAAGHMDLHSRHSSIDLPQLARWAADVGADAGL
QQQILAANTSQQALAMSAAAGVPLGDEVCRHALNFARSIVPASVQVEVFAIDRQGGLVGQ
AGVDSQREIT