Protein Info for Psyr_4398 in Pseudomonas syringae pv. syringae B728a

Annotation: Protein-disulfide reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 606 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details transmembrane" amino acids 191 to 218 (28 residues), see Phobius details amino acids 230 to 254 (25 residues), see Phobius details amino acids 265 to 288 (24 residues), see Phobius details amino acids 309 to 339 (31 residues), see Phobius details amino acids 352 to 374 (23 residues), see Phobius details amino acids 382 to 403 (22 residues), see Phobius details amino acids 409 to 429 (21 residues), see Phobius details amino acids 438 to 458 (21 residues), see Phobius details PF11412: DsbD_N" amino acids 49 to 160 (112 residues), 109 bits, see alignment E=4.6e-35 PF02683: DsbD_TM" amino acids 187 to 404 (218 residues), 238.9 bits, see alignment E=1.2e-74 PF13386: DsbD_2" amino acids 193 to 376 (184 residues), 30.7 bits, see alignment E=9e-11 PF13899: Thioredoxin_7" amino acids 495 to 575 (81 residues), 46.3 bits, see alignment E=1.1e-15 PF13098: Thioredoxin_2" amino acids 497 to 600 (104 residues), 43.9 bits, see alignment E=8.5e-15 PF00085: Thioredoxin" amino acids 499 to 598 (100 residues), 25.3 bits, see alignment E=3.7e-09

Best Hits

KEGG orthology group: K04084, thiol:disulfide interchange protein DsbD [EC: 1.8.1.8] (inferred from 100% identity to psb:Psyr_4398)

Predicted SEED Role

"Cytochrome c-type biogenesis protein DsbD, protein-disulfide reductase (EC 1.8.1.8)" in subsystem Biogenesis of c-type cytochromes or Periplasmic disulfide interchange (EC 1.8.1.8)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.8.1.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZN44 at UniProt or InterPro

Protein Sequence (606 amino acids)

>Psyr_4398 Protein-disulfide reductase (Pseudomonas syringae pv. syringae B728a)
MRGLSIFETAMRRLLCLLLLILALPASGAGLLDSRPSSTLGGGSLDNSKDFLPVRQAFQL
SLIETTPESIKLRLVATDGYYLYRHRFQFRTEPADIGLGQAQLPKGEQKHDEYFGDVEVY
HGILDIDLPRKPGEQRPFTLAVTYQGCADKGLCYPPETERLSIGDVAASPAEQASATPPA
ATAAWSWKELALFFLAGVGLTFTPCVLPMLPILSGVVLRGQVGGLRGLSLSLAYVLPMAA
CFALLGALMGVFGAGLNLQARLQSAWVLVPFSAFFVIFAIAMFGAFELRLPQSISSRLDR
IAGKTQGGSLWGAAVLGVVSSLLVSPCVSAPLAGALLYISASGDALGGALKLFALGLGMG
APLLLIATGGATWLPKSGPWLVTVKNAIGVLLLGLAIGLLSRVLPGQVTLLLVGLLSAGV
ALFLGALEFNIKTTRQKLAQLLGLALLVYALACWYGALSGQTDPMRPLGREYAPANNGAA
ASVASQWQTITTSAELDRVMQEARRESKPLVLDWYADWCISCKVIEHEVLPDPGVVARLS
GYKQVRFDMTDSNAEQRALLDRYKLFGPPALLFFDKNGEERQTVRVIGEIDAAGLIERLN
SANDQN