Protein Info for Psyr_4371 in Pseudomonas syringae pv. syringae B728a

Annotation: DedA:Phosphoesterase, PA-phosphatase related protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 438 transmembrane" amino acids 19 to 51 (33 residues), see Phobius details amino acids 59 to 80 (22 residues), see Phobius details amino acids 107 to 123 (17 residues), see Phobius details amino acids 143 to 164 (22 residues), see Phobius details amino acids 177 to 196 (20 residues), see Phobius details amino acids 208 to 229 (22 residues), see Phobius details amino acids 250 to 277 (28 residues), see Phobius details amino acids 284 to 304 (21 residues), see Phobius details amino acids 324 to 341 (18 residues), see Phobius details amino acids 351 to 372 (22 residues), see Phobius details amino acids 378 to 397 (20 residues), see Phobius details amino acids 409 to 429 (21 residues), see Phobius details PF09335: VTT_dom" amino acids 39 to 163 (125 residues), 78.1 bits, see alignment E=8.6e-26 PF01569: PAP2" amino acids 285 to 399 (115 residues), 77.4 bits, see alignment E=8.6e-26

Best Hits

KEGG orthology group: None (inferred from 100% identity to psb:Psyr_4371)

Predicted SEED Role

"DedA protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZN71 at UniProt or InterPro

Protein Sequence (438 amino acids)

>Psyr_4371 DedA:Phosphoesterase, PA-phosphatase related protein (Pseudomonas syringae pv. syringae B728a)
MGDLLNGMTGWLTANPSWVAVAIFLVAFIECVAIVGIVVPGTVIMFAIAALAGSGILPLS
EVLLLGFLGGLLGDAVSYFVGRRFHQNIRQLPGLRTHPEWMEGAEKYFHRYGIASLLVGR
FIGPLRPMLPMIAGMCDMPLPRFVAVSVLAAAGWSIAYLMPGWAAGAAIRLPLPEGFWPE
AAVVGGGLAVLFGLSIQSSIRQKRYATRLISALSLTLVAALFFGFPLLADFDNGLMTLIQ
EHRSEATQHIVVFVTSIGDFRAQLLAASLLIIVLAVARQWRHAAFALTATLGTAIANGIL
KTFFARARPEVLLEPLTTYSMPSGHSSAAFALFMTLAVLAGRGQPVRLRLTWMLVAGIPA
LAIALSRVYLGVHWPTDILAGMLLAFCVCAASLALIQRKDPLPAMSVRVWWLVVPAMTAL
LGIFAVRALSHGVLRYQY