Protein Info for Psyr_4365 in Pseudomonas syringae pv. syringae B728a

Annotation: cell elongation-specific peptidoglycan D,D-transpeptidase / peptidoglycan glycosyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 631 transmembrane" amino acids 21 to 41 (21 residues), see Phobius details TIGR03423: penicillin-binding protein 2" amino acids 20 to 607 (588 residues), 781.1 bits, see alignment E=3.6e-239 PF03717: PBP_dimer" amino acids 63 to 236 (174 residues), 150.3 bits, see alignment E=8.6e-48 PF00905: Transpeptidase" amino acids 268 to 603 (336 residues), 243 bits, see alignment E=4.1e-76

Best Hits

Swiss-Prot: 43% identical to MRDA_HAEIN: Peptidoglycan D,D-transpeptidase MrdA (mrdA) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K05515, penicillin-binding protein 2 (inferred from 100% identity to psb:Psyr_4365)

Predicted SEED Role

"Penicillin-binding protein 2 (PBP-2)" in subsystem Peptidoglycan Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZN77 at UniProt or InterPro

Protein Sequence (631 amino acids)

>Psyr_4365 cell elongation-specific peptidoglycan D,D-transpeptidase / peptidoglycan glycosyltransferase (Pseudomonas syringae pv. syringae B728a)
MSQPIRLKDHEKDARLVRGRVVFGAVAVVLLVCVLIARLYYLQVIQYEYHSTLSENNRVH
VQPIPPSRGLIYDRNGVVVADNRPSFSLSMTRERAGEWSSVLDTIVEILQLTPDDRIIFE
KRMKQGRRPFEPVPILFELSEEQIALIAVNQFRLPGVEVVAQLVRHYPQGPHFAHSVGYM
GRINEKELKSLDPINYSGTHHIGKTGIERFYEPELHGQVGYEEVETNARGRVLRVLKRTD
PIPGKDIVLSLDIKLQEAAEAALGGRRGAVVALDPATGEVLAMVSAPSFDPNLFVTGISF
KAYAELRDSIDRPLFNRILRGLYPPGSTIKPAVAIAGLDTGAVTPGSRVFDPGYYQLPNY
DHKYRNWNRTGDGWVDLDTAIMRSNDTYFYDLAHKVGIDRLATYMNKFGIGQKVSLDMFE
ESPGLMPSREWKRATRRQAWFPGETLILGIGQGYMQATPLQLAQATALVANKGVWNRPHL
ARTIEGKAPVDENPMPDIVLRDPANWGRVNHGMQEVMHGARGTARKAAIGAQYRIAGKSG
TAQVVAIKQGEKYDRTKVQERHRDHALFVGFAPADNPKIVVAVMVENGESGSGVAAPVVR
QVLDAWLLDENGHLKPEYAGSLNLEAAAREE