Protein Info for Psyr_4338 in Pseudomonas syringae pv. syringae B728a

Annotation: Acyl-CoA dehydrogenase, C-terminal:Acyl-CoA dehydrogenase, central region

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 549 PF18158: AidB_N" amino acids 14 to 168 (155 residues), 206.4 bits, see alignment E=6.5e-65 PF02770: Acyl-CoA_dh_M" amino acids 182 to 279 (98 residues), 51.7 bits, see alignment E=2.1e-17 PF00441: Acyl-CoA_dh_1" amino acids 290 to 444 (155 residues), 98.2 bits, see alignment E=1.3e-31 PF08028: Acyl-CoA_dh_2" amino acids 316 to 426 (111 residues), 35.3 bits, see alignment E=3.4e-12 PF22924: ACOX_C_alpha1" amino acids 376 to 444 (69 residues), 31.1 bits, see alignment E=5e-11

Best Hits

KEGG orthology group: K09456, putative acyl-CoA dehydrogenase (inferred from 100% identity to psb:Psyr_4338)

Predicted SEED Role

"Acyl-CoA dehydrogenase (EC 1.3.8.7)" (EC 1.3.8.7)

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 1.3.8.7

Use Curated BLAST to search for 1.3.8.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZNA4 at UniProt or InterPro

Protein Sequence (549 amino acids)

>Psyr_4338 Acyl-CoA dehydrogenase, C-terminal:Acyl-CoA dehydrogenase, central region (Pseudomonas syringae pv. syringae B728a)
MNLNQFAETHEVTNQPPPLDGANLYRIDVPLQEWSSRFGAGWAQPRIDAYGALAGGPLMA
AGFLANQHRPEFASHDRYGHRIDLVEFHPAYHQLMSTAIAHGIPSLPWTEPQPGAHVARA
AMSYLHTQAEPGSGCPLTMTFASVPALRLQPDLAEIWLPKVLSTEYDPRNVGIAHKNGAT
IGMAMTEKQGGTDVRANTTRAFSVGAGGPGQAYELVGHKWFCSAPMCDAFLTLAQTDKGL
SCFLLPRHRPDDTRNEFYIQRLKNKLGNWSNASSEVEFRGALAWMIGEEGRGVPTIIEMV
AMTRFDCMIGSSALMRQALTQATHHCAHRAVSGRLLAEQPLMQNVLADLALESEAALALT
LRVGRALDHLDDDHEKRFVRLVTAVGKYWICKRAPAMINEAAECLGGAGYVEDSIVPRLY
REAPVNSTWEGSGNVQCLDVLRTLSKEPGALDALFDELGDGHGDRHLAAHIGSLKAAFQD
TGDIQYRARQLTEDIAIALQGKLLLEAGNAAVSDGFIAGRIASGGRVYGALPTGVDVETL
LQRSSPQVA