Protein Info for Psyr_4317 in Pseudomonas syringae pv. syringae B728a

Annotation: Probable taurine catabolism dioxygenase-like protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 337 PF02668: TauD" amino acids 16 to 294 (279 residues), 164.6 bits, see alignment E=2.3e-52

Best Hits

KEGG orthology group: None (inferred from 100% identity to psb:Psyr_4317)

Predicted SEED Role

"similar to Probable taurine catabolism dioxygenase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZNC5 at UniProt or InterPro

Protein Sequence (337 amino acids)

>Psyr_4317 Probable taurine catabolism dioxygenase-like protein (Pseudomonas syringae pv. syringae B728a)
MGLKLSSVPFEISYPAQSFGVEIENLKLHKNLSFDTIAAIKKCLAYRGFVLFRNQNLTRR
EQVAVTRLLGNPNLKSHSWAPQIETTTFGDDEVIPNGLPLINHGEILYFVNGPDFCDKTQ
DEHAIWDEKDNHTKGKGTSCWHTGDSEAINVETINCLYAELAAAQGGATLFCDTVAAYND
LEDSLKKRIDNLRVLHYFVDPQRTEPVNQPLVKTNPITRQKYLYLNYNTMERVEGLSKSE
SYRLLKFLFDHQIKDQYVYEHFWKQDDFLIWNCNGTMHKRGALVSNHNRIMRRTQAIIPE
FTSYYERDKSLAVTSHDNEDWHPYPFERAELESAGSA