Protein Info for Psyr_4300 in Pseudomonas syringae pv. syringae B728a

Annotation: DNA polymerase III, epsilon subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00573: exonuclease, DNA polymerase III, epsilon subunit family
  • amino acids 5 to 188 (184 residues), 79.9 bits, E=9.4e-27
• PF00929: RNase_T
  • amino acids 7 to 161 (155 residues), 103.1 bits, E=1.2e-33

Best Hits

KEGG orthology group: K02342, DNA polymerase III subunit epsilon [EC: 2.7.7.7] (inferred from 100% identity to psb:Psyr_4300)

Predicted SEED Role

"DNA polymerase III alpha subunit (EC 2.7.7.7)" in subsystem DNA-replication (EC 2.7.7.7)

KEGG Metabolic Maps

• Purine metabolism
• Pyrimidine metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.7.7.7

Use Curated BLAST to search for 2.7.7.7

Sequence Analysis Tools

See Q4ZNE2 at UniProt or InterPro

Protein Sequence (204 amino acids)

>Psyr_4300 DNA polymerase III, epsilon subunit (Pseudomonas syringae pv. syringae B728a)
MLERIAVIDFETTGISPGHSCRATEIAVVIMEQGRIVERFQSLMNAGVRIPAFIEGLTGI
SNNMIRTAPSAERVMGDVADFVGSTPLVAHNASFDQKFWDYELSRIQRTREQSFACSLLL
ARRLMPGAPNHKLGTLTRYARLPDTGKAHRAMADAEMAANLTAHLTNELRQTHGISAISH
QMLCSLQKVPAAKISETLKRQRGV