Protein Info for Psyr_4296 in Pseudomonas syringae pv. syringae B728a

Annotation: HI0933-like protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 424 PF03486: HI0933_like" amino acids 23 to 414 (392 residues), 385.4 bits, see alignment E=1e-118 PF01494: FAD_binding_3" amino acids 23 to 51 (29 residues), 25.1 bits, see alignment (E = 3.5e-09) TIGR00275: flavoprotein, HI0933 family" amino acids 24 to 414 (391 residues), 284.5 bits, see alignment E=1.3e-88 PF13450: NAD_binding_8" amino acids 26 to 57 (32 residues), 26 bits, see alignment (E = 3.2e-09) TIGR03862: flavoprotein, TIGR03862 family" amino acids 44 to 422 (379 residues), 536.2 bits, see alignment E=3.8e-165

Best Hits

KEGG orthology group: K07007, (no description) (inferred from 100% identity to psb:Psyr_4296)

Predicted SEED Role

"NAD(FAD)-utilizing dehydrogenases"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZNE6 at UniProt or InterPro

Protein Sequence (424 amino acids)

>Psyr_4296 HI0933-like protein (Pseudomonas syringae pv. syringae B728a)
MPHPSAIDTSLTMTDLALSAARTVAIIGGGPAGLMAAEVLSQAGLKVDLYDAMPSVGRKF
LLAGVGGMNITHSEPYPAFLARYAERSPMIAPLLRGFDADTLCQWIHALGIETFVGSSGR
VFPTDMKAAPLLRAWLKRLRDAGVTIHTRHRWSGWNADGSLRIANADGERAIKPAATLLA
LGGASWARLGSDGAWLPWLQARQVEVAPLQAANCGFEVSAWSDLLRDKFAGAPLKNIAMG
LHGHALRLGECVLTATGVEGSLVYALSAQIREQINLHGSAIVDIDLLPGKTLADIQKALS
KPRGSRSMSKHLHSQLGLDGAKAALLRELAPREAFADPLVLSEAIKALPLPLIKPRPIDE
AISTAGGVTFEAMDERLMLRQLPGVFCAGEMLDWEAPTGGYLLTACFASGRAAGLGMVQW
LQSR