Protein Info for Psyr_4294 in Pseudomonas syringae pv. syringae B728a

Annotation: Histone deacetylase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 189 PF13302: Acetyltransf_3" amino acids 11 to 152 (142 residues), 119.2 bits, see alignment E=2.2e-38 PF00583: Acetyltransf_1" amino acids 61 to 150 (90 residues), 31 bits, see alignment E=2.8e-11

Best Hits

Swiss-Prot: 52% identical to ATSE3_PSEAE: Acetyltransferase PA3944 (PA3944) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: None (inferred from 100% identity to psb:Psyr_4294)

Predicted SEED Role

"acetyltransferase, GNAT family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZNE8 at UniProt or InterPro

Protein Sequence (189 amino acids)

>Psyr_4294 Histone deacetylase family protein (Pseudomonas syringae pv. syringae B728a)
MEPILKLDSARLLMRQWRDDDLPAFADMCADPRVMRYFPDPLSRLESAAMIGRLRGHFAE
LGFGFWALERKDTGEFIGFTGLHVVGFKAPFTPAVEIGWRLAHKHWGLGFASEAAWTALG
CGFERLELKEIVSFTAVNNQPSQKVMQAIGMQQDESGNFDHPNLADGHPLKPHVLYRISH
EQWLKTLKP