Protein Info for Psyr_4287 in Pseudomonas syringae pv. syringae B728a

Annotation: tRNA (uracil-5-)-methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 361 TIGR02143: tRNA (uracil(54)-C(5))-methyltransferase" amino acids 9 to 361 (353 residues), 581.9 bits, see alignment E=2.1e-179 PF05958: tRNA_U5-meth_tr" amino acids 10 to 360 (351 residues), 553.2 bits, see alignment E=4.9e-170 PF13847: Methyltransf_31" amino acids 208 to 268 (61 residues), 27.3 bits, see alignment E=5.7e-10 PF13649: Methyltransf_25" amino acids 210 to 269 (60 residues), 29.1 bits, see alignment E=2.7e-10

Best Hits

Swiss-Prot: 100% identical to TRMA_PSEU2: tRNA/tmRNA (uracil-C(5))-methyltransferase (trmA) from Pseudomonas syringae pv. syringae (strain B728a)

KEGG orthology group: K00557, tRNA (uracil-5-)-methyltransferase [EC: 2.1.1.35] (inferred from 100% identity to psb:Psyr_4287)

MetaCyc: 51% identical to tRNA m5U54 methyltransferase (Escherichia coli K-12 substr. MG1655)
tRNA (uracil-5-)-methyltransferase. [EC: 2.1.1.35]

Predicted SEED Role

No annotation

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.1.35

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZNF5 at UniProt or InterPro

Protein Sequence (361 amino acids)

>Psyr_4287 tRNA (uracil-5-)-methyltransferase (Pseudomonas syringae pv. syringae B728a)
MSVPFDPASYDRQLEEKTVRLRELLAPFDAPEPQVFDSPREHYRLRAEFRLWREDQKRYY
AMFAPGDNRTPILLEGLPIASERINALMPVLRERWEASPTLNHKLFQVDFLTTLAGDAMI
TLCYHRPLDAEWQAAAAQLAAELDVSLIGRSKGQKLVIGHDYVTEKLDVAGRTFSYRQPE
GAFTQPNGTVNGKMLNWAFDALGERQDDLLELYCGNGNFTLPLATRVRKVLATEISKTSV
NAALSNLDDNGVDNVTLVRLSAEELTEALNEVRPFRRLHGVDLKSYDFGSVFVDPPRAGM
DPDTCELTRRFERILYISCNPETLAANIAQLHDTHRVERCALFDQFPYTHHMESGVLLVR
R