Protein Info for Psyr_4285 in Pseudomonas syringae pv. syringae B728a

Annotation: Ferredoxin:[2Fe-2S]-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 176 PF00111: Fer2" amino acids 19 to 66 (48 residues), 30.6 bits, see alignment E=2.7e-11 PF01799: Fer2_2" amino acids 86 to 159 (74 residues), 106.7 bits, see alignment E=5.3e-35

Best Hits

Swiss-Prot: 45% identical to CUTC_SULAC: Glyceraldehyde dehydrogenase small chain (cutC) from Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770)

KEGG orthology group: K13483, xanthine dehydrogenase YagT iron-sulfur-binding subunit (inferred from 100% identity to psb:Psyr_4285)

MetaCyc: 50% identical to 1-testosterone hydratase/dehydrogenase gamma subunit (Steroidobacter denitrificans)
RXN-21494 [EC: 1.17.99.11]; 1.17.99.11 [EC: 1.17.99.11]; 1.17.99.11 [EC: 1.17.99.11]

Predicted SEED Role

No annotation

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.17.99.11

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZNF7 at UniProt or InterPro

Protein Sequence (176 amino acids)

>Psyr_4285 Ferredoxin:[2Fe-2S]-binding protein (Pseudomonas syringae pv. syringae B728a)
MSATTPNPQDFATHAISLTLNGQLRQLDVLPWTTLLDLLRDQLDLVGTKKGCDHGQCGAC
TVLRDGTRINACLTLAIMCDGAELTTIEGLADGDQLHPMQQAFIKNDAFQCGYCTPGQIC
SAVGLANEGRASTRAEIQELMSGNLCRCGAYSNILAAVEEALPQFHNAAPKPEVNA