Protein Info for Psyr_4257 in Pseudomonas syringae pv. syringae B728a

Annotation: Uncharacterized protein UPF0114

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 162 transmembrane" amino acids 14 to 33 (20 residues), see Phobius details amino acids 53 to 76 (24 residues), see Phobius details amino acids 107 to 125 (19 residues), see Phobius details amino acids 136 to 156 (21 residues), see Phobius details TIGR00645: TIGR00645 family protein" amino acids 1 to 160 (160 residues), 235.3 bits, see alignment E=2.2e-74 PF03350: UPF0114" amino acids 9 to 125 (117 residues), 129.1 bits, see alignment E=5.1e-42

Best Hits

Swiss-Prot: 100% identical to Y4257_PSEU2: UPF0114 protein Psyr_4257 (Psyr_4257) from Pseudomonas syringae pv. syringae (strain B728a)

KEGG orthology group: None (inferred from 99% identity to pst:PSPTO_4583)

Predicted SEED Role

"Putative inner membrane protein (Fragment)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZNI5 at UniProt or InterPro

Protein Sequence (162 amino acids)

>Psyr_4257 Uncharacterized protein UPF0114 (Pseudomonas syringae pv. syringae B728a)
MERFFENAMYASRWLLAPIYFGLSLGLLALCLKFFQEIFHVIPNIFSLAEADLILVLLSL
IDMALVGGLLVMVMISGYENFVSQLDIDEDKEKLNWLGTMDSSSLKMKVAASIVAISSIH
LLRVFMDATNIKPEYLMWYVIIHMTFVISAFAMGYLDKVTKH