Protein Info for Psyr_4231 in Pseudomonas syringae pv. syringae B728a

Annotation: ATP-binding region, ATPase-like:Histidine kinase A, N-terminal

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 419 transmembrane" amino acids 20 to 39 (20 residues), see Phobius details amino acids 45 to 66 (22 residues), see Phobius details amino acids 78 to 97 (20 residues), see Phobius details amino acids 103 to 120 (18 residues), see Phobius details amino acids 124 to 142 (19 residues), see Phobius details amino acids 155 to 176 (22 residues), see Phobius details PF00512: HisKA" amino acids 206 to 259 (54 residues), 29.7 bits, see alignment 5.5e-11 PF02518: HATPase_c" amino acids 313 to 413 (101 residues), 70.8 bits, see alignment E=1.3e-23

Best Hits

KEGG orthology group: K15011, two-component system, sensor histidine kinase RegB [EC: 2.7.13.3] (inferred from 100% identity to psb:Psyr_4231)

Predicted SEED Role

"Sensor histidine kinase PrrB (RegB) (EC 2.7.3.-)" (EC 2.7.3.-)

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3, 2.7.3.-

Use Curated BLAST to search for 2.7.13.3 or 2.7.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZNL1 at UniProt or InterPro

Protein Sequence (419 amino acids)

>Psyr_4231 ATP-binding region, ATPase-like:Histidine kinase A, N-terminal (Pseudomonas syringae pv. syringae B728a)
MLAPVKMLSATRQNLWRLTFIRILVLAAQAGSVGMAWLFDFLPLPWLQLSITLGCSLVLC
GLTVIRLRTSLPLTELEYALQLALDLLIHSALLYYSGGSANPFVSYYLVPLTIAAATLPW
RYSLILSGFALSMYTLLMVRSYPLETDSIARENMQIYGMWLSFALAAAVITFFAAKMAEE
LRRQEQLRAERREEGLRDQQLLAVATQAAGAAHELGTPLATMSVLLKEMRQDHSDPALQD
DLSVLQEQVKQCKQTLQQLVRAAEANRRMAVEYQAATRWLDESLNRWHLMRPEVSYRFYK
LGKGEAPMLAPPPDLTQALLNLLNNAADACPDGLEVNLDWDSAEICISIRDHGAGVPLAI
AEQIGKPFFTTKGKGFGLGLFLSKASVTRAGGSVKLYSHEEGGTLTELRLPRDTRGEEA