Protein Info for Psyr_4226 in Pseudomonas syringae pv. syringae B728a

Annotation: D-galactonate transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 461 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details transmembrane" amino acids 44 to 67 (24 residues), see Phobius details amino acids 79 to 97 (19 residues), see Phobius details amino acids 103 to 121 (19 residues), see Phobius details amino acids 145 to 167 (23 residues), see Phobius details amino acids 173 to 193 (21 residues), see Phobius details amino acids 250 to 273 (24 residues), see Phobius details amino acids 286 to 311 (26 residues), see Phobius details amino acids 323 to 341 (19 residues), see Phobius details amino acids 347 to 368 (22 residues), see Phobius details amino acids 380 to 403 (24 residues), see Phobius details amino acids 409 to 430 (22 residues), see Phobius details PF07690: MFS_1" amino acids 17 to 310 (294 residues), 168.4 bits, see alignment E=2.1e-53 TIGR00893: D-galactonate transporter" amino acids 19 to 431 (413 residues), 514.9 bits, see alignment E=7.5e-159

Best Hits

Swiss-Prot: 68% identical to GUDP_BACSU: Probable glucarate transporter (gudP) from Bacillus subtilis (strain 168)

KEGG orthology group: K03535, MFS transporter, ACS family, glucarate transporter (inferred from 100% identity to psb:Psyr_4226)

MetaCyc: 62% identical to galactarate/D-glucarate transporter GarP (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-203; TRANS-RXN0-204; TRANS-RXN0-523

Predicted SEED Role

"D-galactarate permease" in subsystem D-galactarate, D-glucarate and D-glycerate catabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZNL6 at UniProt or InterPro

Protein Sequence (461 amino acids)

>Psyr_4226 D-galactonate transporter (Pseudomonas syringae pv. syringae B728a)
MQKSKPTHVRYLILLMLFLVTTINYADRATIAIAGSSIQKDLGISAVTLGYIFSAFGWAY
VAGQIPGGWLLDRFGSKKVYAMSIFTWSLFTLLQGYVGEFGVSTAIVALFMLRFLVGLAE
APSFPGNARIVAAWFPTAERGTASAIFNSAQYFATVLFAPLMGWIVYTYGWQHVFVVMGA
FGIVFSMIWMKVIYGPRNHPMINEAELEHISSNGALVDLDQDKGKGAQKTASSGPKWDYI
RQLLTNRMMLGIYLSQYCINGITYFFLTWFPVYLVQERGMTILKAGIIASLPAICGFIGG
VLGGIISDYLLRKGHSLTFARKAPIIGGLLLSTSIVTCNYVDIEWVVVGFMALAFFGKGV
GALGWAVMSDVSPKQIAGLSGGLFNTFGNIASITTPIVIGYIISSTGSFKWALVFVGANA
LLAVISYIFIVGEIKRVELKEPPAKGPLLNDSVSDLSEAKS