Protein Info for Psyr_4222 in Pseudomonas syringae pv. syringae B728a

Annotation: Protein of unknown function DUF81

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 261 transmembrane" amino acids 7 to 27 (21 residues), see Phobius details amino acids 33 to 53 (21 residues), see Phobius details amino acids 74 to 93 (20 residues), see Phobius details amino acids 104 to 123 (20 residues), see Phobius details amino acids 137 to 157 (21 residues), see Phobius details amino acids 163 to 183 (21 residues), see Phobius details amino acids 193 to 210 (18 residues), see Phobius details amino acids 217 to 236 (20 residues), see Phobius details amino acids 243 to 260 (18 residues), see Phobius details PF01925: TauE" amino acids 9 to 259 (251 residues), 168.2 bits, see alignment E=1.3e-53

Best Hits

KEGG orthology group: K07090, (no description) (inferred from 100% identity to psb:Psyr_4222)

Predicted SEED Role

"Putative sulfate permease"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZNM0 at UniProt or InterPro

Protein Sequence (261 amino acids)

>Psyr_4222 Protein of unknown function DUF81 (Pseudomonas syringae pv. syringae B728a)
MEAGGLGFVIAGLVVGFIVGMTGVGGGSLMTPILLWFGINPATAVGTDLLYAAITKSGGV
LVHRKNDNIDWKVTGLLTLGSVPAVLMTLWFLSTLHTAPEALNAIIKQALGFVLLLTALA
VLFKKKLLAFAHRREDGYSFFSGTSLTVLTVITGLILGTMVALTSIGAGALGTVALFILY
PLLPTRRLVGTEIAHAVPLTLVAGLGHASMGNMNWELLGWLLMGSLPGIYLGSHMAGRVS
DDLLRPFLAIMLGTIGFKLAF