Protein Info for Psyr_4217 in Pseudomonas syringae pv. syringae B728a

Annotation: tricorn interacting aminopeptidase F1, Serine peptidase, MEROPS family S33

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 307 TIGR01250: proline-specific peptidase" amino acids 8 to 295 (288 residues), 264.9 bits, see alignment E=5.1e-83 PF00561: Abhydrolase_1" amino acids 32 to 283 (252 residues), 81.8 bits, see alignment E=9.6e-27 PF12697: Abhydrolase_6" amino acids 33 to 283 (251 residues), 51.2 bits, see alignment E=4e-17 PF12146: Hydrolase_4" amino acids 33 to 282 (250 residues), 51.4 bits, see alignment E=1.5e-17

Best Hits

Swiss-Prot: 69% identical to LAAA_PSEAZ: L-amino acid amidase (laaA) from Pseudomonas azotoformans

KEGG orthology group: K01259, proline iminopeptidase [EC: 3.4.11.5] (inferred from 100% identity to psb:Psyr_4217)

MetaCyc: 69% identical to L-proline amide hydrolase (Pseudomonas azotoformans)
RXN-10757 [EC: 3.5.1.101]; 3.5.1.101 [EC: 3.5.1.101]

Predicted SEED Role

"Proline iminopeptidase (EC 3.4.11.5)" in subsystem Proline, 4-hydroxyproline uptake and utilization (EC 3.4.11.5)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.4.11.5

Use Curated BLAST to search for 3.4.11.5 or 3.5.1.101

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZNM5 at UniProt or InterPro

Protein Sequence (307 amino acids)

>Psyr_4217 tricorn interacting aminopeptidase F1, Serine peptidase, MEROPS family S33 (Pseudomonas syringae pv. syringae B728a)
MADMTIKEGFAPFGDYQTWYRITGDLHGPGTPLVILHGGPGCTHDYVDAFKDIASTGRAV
IHYDQLGNGKSTRLPHKGRDFWTVDLFLSELDNLLAHLSIKNNYALLGQSWGGMLAAEHA
VRQPAGLKALIIANSPADMLTWVNEANRLREDLPADVQAALLKHEEAGTLKDPEYLKASR
AFYDRHVCRITPWPEEVKRTFDAIDADPTVYHAMNGPTEFHVIGTMKNWTIVDRLKLINV
PALLISGKYDEATPLVVKPYVDNVPDISWSVFEESSHMPHVEERMACMGCIAGFLDKLVV
TGNEFAA