Protein Info for Psyr_4213 in Pseudomonas syringae pv. syringae B728a

Annotation: Oligopeptide/dipeptide ABC transporter, ATP-binding protein, C-terminal

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 330 PF00005: ABC_tran" amino acids 26 to 185 (160 residues), 102.6 bits, see alignment E=5.7e-33 PF13401: AAA_22" amino acids 36 to 213 (178 residues), 28.6 bits, see alignment E=3.1e-10 TIGR01727: oligopeptide/dipeptide ABC transporter, ATP-binding protein, C-terminal domain" amino acids 235 to 320 (86 residues), 70.7 bits, see alignment E=4.2e-24 PF08352: oligo_HPY" amino acids 237 to 300 (64 residues), 62.5 bits, see alignment E=7.8e-21

Best Hits

Swiss-Prot: 49% identical to Y4TR_SINFN: Probable peptide ABC transporter ATP-binding protein y4tR (NGR_a01410) from Sinorhizobium fredii (strain NBRC 101917 / NGR234)

KEGG orthology group: K02031, peptide/nickel transport system ATP-binding protein (inferred from 100% identity to psb:Psyr_4213)

MetaCyc: 45% identical to dipeptide ABC transporter ATP binding subunit DppD (Escherichia coli K-12 substr. MG1655)
ABC-8-RXN [EC: 7.4.2.9]

Predicted SEED Role

"Oligopeptide transport ATP-binding protein OppD (TC 3.A.1.5.1)" in subsystem ABC transporter oligopeptide (TC 3.A.1.5.1) (TC 3.A.1.5.1)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZNM9 at UniProt or InterPro

Protein Sequence (330 amino acids)

>Psyr_4213 Oligopeptide/dipeptide ABC transporter, ATP-binding protein, C-terminal (Pseudomonas syringae pv. syringae B728a)
MSTPVLQVSEMSVVASHRGREVTLVDRLSFDLHQGEILGLVGESGSGKTMACRALMQLMP
SPDLHVRGGSVHLNDVDLLKLDAAGMRAMRGRRIGMIFQNPSSHLDPLMRIGEQIAEGVR
LHQGASKREARAQAIDLLRQVGIPDPASRVDNFPHEFSGGMRQRAMIAVALGCGPQVLIA
DEPTTALDVTVQAQILRLLLDLRDRHGLSLIMITHDLGVVAQTCDSIAVMYAGRLCEHGS
KRDVLARARHPYTHGLIECQPASSAGSELLRTIPGQPPLLDALPGGCRFHARCSHAGADC
PDRLPLMRPMGVAHAAACHYPLVQSREAVS