Protein Info for Psyr_4206 in Pseudomonas syringae pv. syringae B728a

Annotation: GGDEF domain protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 361 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 39 to 58 (20 residues), see Phobius details amino acids 65 to 83 (19 residues), see Phobius details amino acids 95 to 136 (42 residues), see Phobius details amino acids 144 to 167 (24 residues), see Phobius details TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 178 to 328 (151 residues), 108.3 bits, see alignment E=1.7e-35 PF00990: GGDEF" amino acids 182 to 328 (147 residues), 106.6 bits, see alignment E=6e-35

Best Hits

KEGG orthology group: None (inferred from 100% identity to psb:Psyr_4206)

Predicted SEED Role

"FIG00957770: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZNN6 at UniProt or InterPro

Protein Sequence (361 amino acids)

>Psyr_4206 GGDEF domain protein (Pseudomonas syringae pv. syringae B728a)
MPQRRNLKNSIFVPLKLSQLIGLFSWVISWCLNPSIDRSLDIFICCALAGAALSIIVTSN
SRSMLAWRLFGIIYMASLTFLFNEQIDRMGEEASMWGLVVTSLLITGMSVFFVKFIDYIA
AAALIWLIMWQTDLTAVGVDHVPLFYVFLISSTLLGGCLNATFLSLIMQTMAARDRYQEL
SETDTLTHAPNRRALVAGLNTALASADKSSLWFAMLDLDHFKSINDTHGHDVGDNVLISF
ATLLKSTKGLISFGRLGGEEFGVILSAANATDAIHALEGLLMLAQHDDAAQVPYSFSGGV
ASLSRVETINDLLKEADENLYYAKRSGRICIAFEGRIVSSNAVSTTKHNQATQSVEKPTH
A