Protein Info for Psyr_4193 in Pseudomonas syringae pv. syringae B728a

Annotation: dihydrodipicolinate reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 267 PF01113: DapB_N" amino acids 3 to 125 (123 residues), 152 bits, see alignment E=8.6e-49 TIGR00036: 4-hydroxy-tetrahydrodipicolinate reductase" amino acids 3 to 265 (263 residues), 339 bits, see alignment E=1.1e-105 PF05173: DapB_C" amino acids 128 to 264 (137 residues), 156.9 bits, see alignment E=2.4e-50

Best Hits

Swiss-Prot: 100% identical to DAPB_PSEU2: 4-hydroxy-tetrahydrodipicolinate reductase (dapB) from Pseudomonas syringae pv. syringae (strain B728a)

KEGG orthology group: K00215, dihydrodipicolinate reductase [EC: 1.3.1.26] (inferred from 100% identity to psb:Psyr_4193)

MetaCyc: 63% identical to 4-hydroxy-tetrahydrodipicolinate reductase (Escherichia coli K-12 substr. MG1655)
RXN-14014 [EC: 1.17.1.8]

Predicted SEED Role

"4-hydroxy-tetrahydrodipicolinate reductase (EC 1.17.1.8)" (EC 1.17.1.8)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.17.1.8 or 1.3.1.26

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZNP9 at UniProt or InterPro

Protein Sequence (267 amino acids)

>Psyr_4193 dihydrodipicolinate reductase (Pseudomonas syringae pv. syringae B728a)
MRRIAVVGAAGRMGKTLIEAVQQAPGAGLTAAIDRPDSTLVGADAGELAALGRIGVPLSG
DLAKVADEFDVLIDFTHPSVTLKNLAFCRKAGKAMIIGTTGFSAEEKQRLEEAGKDIPIV
FAANFSVGVNLCLKLLDTAARVLGDEVDIEITEAHHRHKVDAPSGTALRMGEVVANALGR
DLEKVAVYGREGQTGARDRQTIGFATLRAGDIVGDHTVLFAADGERVEITHKASSRMTFA
KGAVRAAMWLDGKAPGLYDMQDVLGLH