Protein Info for Psyr_4178 in Pseudomonas syringae pv. syringae B728a

Annotation: tRNA pseudouridine synthase B

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 305 TIGR00431: tRNA pseudouridine(55) synthase" amino acids 12 to 219 (208 residues), 270.5 bits, see alignment E=5.1e-85 PF01509: TruB_N" amino acids 33 to 180 (148 residues), 189.3 bits, see alignment E=7.6e-60 PF16198: TruB_C_2" amino acids 181 to 242 (62 residues), 70.5 bits, see alignment E=1.6e-23 PF09157: TruB-C_2" amino acids 247 to 302 (56 residues), 68.3 bits, see alignment E=6.5e-23

Best Hits

Swiss-Prot: 100% identical to TRUB_PSEU2: tRNA pseudouridine synthase B (truB) from Pseudomonas syringae pv. syringae (strain B728a)

KEGG orthology group: K03177, tRNA pseudouridine synthase B [EC: 5.4.99.12] (inferred from 99% identity to psp:PSPPH_4187)

Predicted SEED Role

"tRNA pseudouridine synthase B (EC 4.2.1.70)" in subsystem tRNA processing (EC 4.2.1.70)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.70, 5.4.99.12

Use Curated BLAST to search for 4.2.1.70 or 5.4.99.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZNR4 at UniProt or InterPro

Protein Sequence (305 amino acids)

>Psyr_4178 tRNA pseudouridine synthase B (Pseudomonas syringae pv. syringae B728a)
MAQVKRIRRNVSGIILLDKPLGFTSNAALQKVRWLLNAEKAGHTGSLDPLATGVLPLCFG
EATKFSQYLLDSDKSYETLAQLGKTTTTADSEGEVLLTRPVTVGRDDIEAALPHFRGQIS
QIPPMYSALKRDGQPLYKLARAGEVVEREPRSVTIARLELLACEGDTARLSVDCSKGTYI
RTLVEDIGEKLGCGAYVAELRRTQAGPFTLAQTVTLEELEQVHADGGNEAVDRFLMPSDS
GLLDWPLLKFSEHSSFYWLHGQPVRAPDAPKFGMVRVQDHEGRFIGIGEVAEDGRIAPRR
LIRSE