Protein Info for Psyr_4160 in Pseudomonas syringae pv. syringae B728a
Annotation: Maf-like protein
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 100% identical to NTPPA_PSEU2: dTTP/UTP pyrophosphatase (Psyr_4160) from Pseudomonas syringae pv. syringae (strain B728a)
KEGG orthology group: K06287, septum formation protein (inferred from 100% identity to psb:Psyr_4160)MetaCyc: 50% identical to nucleoside triphosphate pyrophosphatase YhdE (Escherichia coli K-12 substr. MG1655)
Nucleotide diphosphatase. [EC: 3.6.1.9]; 3.6.1.9 [EC: 3.6.1.9]
Predicted SEED Role
"Septum formation protein Maf" in subsystem Bacterial Cell Division or Bacterial Cytoskeleton
MetaCyc Pathways
- superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (18/18 steps found)
- pyrimidine deoxyribonucleotides de novo biosynthesis I (9/9 steps found)
- superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (E. coli) (12/14 steps found)
- pyrimidine deoxyribonucleotides de novo biosynthesis III (8/9 steps found)
- pyrimidine deoxyribonucleotides de novo biosynthesis II (5/7 steps found)
- dZTP biosynthesis (3/5 steps found)
- pyrimidine deoxyribonucleotides dephosphorylation (1/3 steps found)
- tunicamycin biosynthesis (2/9 steps found)
KEGG Metabolic Maps
- Nicotinate and nicotinamide metabolism
- Pantothenate and CoA biosynthesis
- Purine metabolism
- Riboflavin metabolism
- Starch and sucrose metabolism
Isozymes
No predicted isozymesUse Curated BLAST to search for 3.6.1.9
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See Q4ZNT2 at UniProt or InterPro
Protein Sequence (200 amino acids)
>Psyr_4160 Maf-like protein (Pseudomonas syringae pv. syringae B728a) MPSLYLASGSPRRRELLTQIGVPFTVLSAQIDETPFDHETPAAYVERLALGKAQAGLSVL PAEQQACVMGADTAVVLDGRILGKPVDEADALAMLMALSGREHQVLTAVALCDRQRSDTR IVTSRVRFRPIQIHEAQAYWTSGEPADKAGGYAIQGLAAIFVEGLQGSYSGVVGLPLCET AELLGHFGIPCWQCLEGDKS