Protein Info for Psyr_4150 in Pseudomonas syringae pv. syringae B728a

Annotation: Uncharacterized P-loop ATPase protein UPF0042

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 285 PF03668: RapZ-like_N" amino acids 1 to 158 (158 residues), 143.4 bits, see alignment E=5.5e-46 PF22740: PapZ_C" amino acids 168 to 284 (117 residues), 156 bits, see alignment E=5e-50

Best Hits

Swiss-Prot: 100% identical to Y4150_PSEU2: Nucleotide-binding protein Psyr_4150 (Psyr_4150) from Pseudomonas syringae pv. syringae (strain B728a)

KEGG orthology group: K06958, UPF0042 nucleotide-binding protein (inferred from 100% identity to psb:Psyr_4150)

Predicted SEED Role

"Hypothetical ATP-binding protein UPF0042, contains P-loop"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZNU2 at UniProt or InterPro

Protein Sequence (285 amino acids)

>Psyr_4150 Uncharacterized P-loop ATPase protein UPF0042 (Pseudomonas syringae pv. syringae B728a)
MRMIIVSGRSGSGKSTALDVLEDNGFYCVDNLPAGLLPELAERALINTELAEPLLAVSID
ARNLPSHLTRFPQMLSEVRLRNIQCDVLYLDADEATLLKRFSETRRRHPLSTADRSLAEA
IRDETALLGPIIDLADLKINTTHLNLYQLRDALKLRLLNKPEPGTAFLIESFGFKRGMPV
DADLVFDVRCLPNPYWKPELRDHSGLEQPVIDYLSVQPDVEEMFQDIFAYLNKWLPRFAA
SNRSYVTIAIGCTGGHHRSVYLTERLGQVLQQSLKNVQVRHRDLS