Protein Info for Psyr_4149 in Pseudomonas syringae pv. syringae B728a

Annotation: PTS IIA-like nitrogen-regulatory protein PtsN

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01419: PTS IIA-like nitrogen-regulatory protein PtsN
  • amino acids 4 to 148 (145 residues), 180.2 bits, E=1e-57
• PF00359: PTS_EIIA_2
  • amino acids 8 to 147 (140 residues), 117.3 bits, E=2.6e-38

Best Hits

Swiss-Prot: 78% identical to PTSN_PSEAE: Nitrogen regulatory protein (ptsN) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K02806, PTS system, nitrogen regulatory IIA component [EC: 2.7.1.69] (inferred from 99% identity to psp:PSPPH_4153)

Predicted SEED Role

No annotation

KEGG Metabolic Maps

• Aminosugars metabolism
• Ascorbate and aldarate metabolism
• Fructose and mannose metabolism
• Galactose metabolism
• Glycolysis / Gluconeogenesis
• Nucleotide sugars metabolism
• Starch and sucrose metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.69

Use Curated BLAST to search for 2.7.1.69

Sequence Analysis Tools

See Q4ZNU3 at UniProt or InterPro

Protein Sequence (154 amino acids)

>Psyr_4149 PTS IIA-like nitrogen-regulatory protein PtsN (Pseudomonas syringae pv. syringae B728a)
MIRIENILTPGRSLVNVPGGSKKRVLEEIANLIGREVPGMVSDTVFASLVAREKLGSTGF
GNGIAIPHCRLADCSEPVSAVIHLSTPVDFDAIDGAPVDLLFVLLVPQAATDEHLELLRQ
IASMLDDKDVRKRLRSAESAEALYQVVLDVQNGN