Protein Info for Psyr_4145 in Pseudomonas syringae pv. syringae B728a

Annotation: OstA-like protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 182 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details TIGR03002: lipopolysaccharide transport periplasmic protein LptA" amino acids 25 to 172 (148 residues), 155.4 bits, see alignment E=4.3e-50 PF03968: LptD_N" amino acids 34 to 145 (112 residues), 98.8 bits, see alignment E=1.2e-32

Best Hits

KEGG orthology group: K09774, lipopolysaccharide export system protein LptA (inferred from 100% identity to psp:PSPPH_4149)

Predicted SEED Role

"LptA, protein essential for LPS transport across the periplasm" in subsystem KDO2-Lipid A biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZNU7 at UniProt or InterPro

Protein Sequence (182 amino acids)

>Psyr_4145 OstA-like protein (Pseudomonas syringae pv. syringae B728a)
MRLVKTLPLLLGLGAALGSASAWSLPTDRDQPIHIQSDDAQLDDKKGVATYKGNVIITQG
SMKITGNTVTITRNAQGEVDVFTSVGNLAYYEQKPAVDKPIVQAYAVTIQYYAGQDRIVL
IDKAKVINDGNTSEGEKIVYDTVRQVVTAGRANGGAKVTTPRPRIDMVIQPKKKTDQPQK
AQ