Protein Info for Psyr_4132 in Pseudomonas syringae pv. syringae B728a

Annotation: histidinol phosphate aminotransferase apoenzyme

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 TIGR01141: histidinol-phosphate transaminase" amino acids 8 to 348 (341 residues), 308 bits, see alignment E=3.8e-96 PF00155: Aminotran_1_2" amino acids 26 to 346 (321 residues), 213.9 bits, see alignment E=2e-67

Best Hits

Swiss-Prot: 100% identical to HIS8_PSEU2: Histidinol-phosphate aminotransferase (hisC) from Pseudomonas syringae pv. syringae (strain B728a)

KEGG orthology group: K00817, histidinol-phosphate aminotransferase [EC: 2.6.1.9] (inferred from 100% identity to psb:Psyr_4132)

Predicted SEED Role

"Histidinol-phosphate aminotransferase (EC 2.6.1.9)" in subsystem Histidine Biosynthesis (EC 2.6.1.9)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.6.1.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZNW0 at UniProt or InterPro

Protein Sequence (350 amino acids)

>Psyr_4132 histidinol phosphate aminotransferase apoenzyme (Pseudomonas syringae pv. syringae B728a)
MSKFWSPFVSDLVPYVPGEQPKLTRLVKLNTNENPYGPSPKAIDAMRTALTDDLRLYPDP
NSDLLKHAVADYYKVQPSQVFLGNGSDEVLAHIFHALFQHDAPLLFPDISYSFYPVYCGL
YGIDYETVPLDEQFQIRAEDYARPNAGIIFPNPNAPTGCLLGLDKVEQIIKASPDSVVVV
DEAYIDFGGETAITLVDRYPNLLVTQTLSKSRSLAGLRVGLAVGHPDLIEALERVKNSFN
SYPLDRMANVGGAAAFEDREHFETTRNKVIESREALVEQLQGKGFEVLPSAANFIFARHP
RHDAAALAAKLREQGVIVRHFKQQRIAQFLRISIGTPEQHQALLEGLSDL