Protein Info for Psyr_4130 in Pseudomonas syringae pv. syringae B728a

Annotation: Peptidase S1, chymotrypsin:PDZ/DHR/GLGF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 386 transmembrane" amino acids 7 to 25 (19 residues), see Phobius details signal peptide" amino acids 26 to 26 (1 residues), see Phobius details TIGR02037: peptidase Do" amino acids 54 to 372 (319 residues), 418 bits, see alignment E=2.3e-129 PF00089: Trypsin" amino acids 105 to 266 (162 residues), 67.8 bits, see alignment E=3.1e-22 PF13365: Trypsin_2" amino acids 107 to 241 (135 residues), 119.2 bits, see alignment E=6.2e-38 PF00595: PDZ" amino acids 276 to 358 (83 residues), 40 bits, see alignment E=1.1e-13 PF13180: PDZ_2" amino acids 281 to 370 (90 residues), 54.4 bits, see alignment E=3.2e-18 PF17820: PDZ_6" amino acids 311 to 347 (37 residues), 35.2 bits, see alignment 2e-12

Best Hits

KEGG orthology group: K04691, serine protease DegS [EC: 3.4.21.-] (inferred from 100% identity to psp:PSPPH_4135)

Predicted SEED Role

"Outer membrane stress sensor protease DegS" in subsystem Proteolysis in bacteria, ATP-dependent

Isozymes

Compare fitness of predicted isozymes for: 3.4.21.-

Use Curated BLAST to search for 3.4.21.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZNW2 at UniProt or InterPro

Protein Sequence (386 amino acids)

>Psyr_4130 Peptidase S1, chymotrypsin:PDZ/DHR/GLGF (Pseudomonas syringae pv. syringae B728a)
MFKALRFFGWPLLAGVLIAMLIIQRYPQWVGLPSLDVNLQQAPQTTNVMQGPSSYADAVI
AAAPAVVNLYTTKMVNKGNNPLFEDPQFRRFFGDNTPKQKRMESSLGSGVMMSPEGYILT
NNHVTTGADQIVVALKDGRETIARVIGNDPETDLAVLKIDLKNLPAITIARSDSIRIGDV
ALAIGNPFGVGQTVTMGIISATGRNQLGLNTYEDFIQTDAAINPGNSGGALVDASGNLIG
INTAIFSKSGGSQGIGFAIPTKLAMDVMKSIIEHGQVIRGWLGIEVQPLTQELAESFGLK
DRPGIVVAGIFRDGPAQKAGLQLGDVILSINGEPAGDGRRSMNQVARTKPKDKIAIDVMR
NGKEMRLSAEVGLRPPPAPTPVAAPE