Protein Info for Psyr_4112 in Pseudomonas syringae pv. syringae B728a

Annotation: Protein of unknown function UPF0011

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 304 TIGR00096: 16S rRNA (cytidine(1402)-2'-O)-methyltransferase" amino acids 29 to 300 (272 residues), 288.9 bits, see alignment E=2.1e-90 PF00590: TP_methylase" amino acids 29 to 228 (200 residues), 110.6 bits, see alignment E=5.1e-36

Best Hits

Swiss-Prot: 78% identical to RSMI_PSEAE: Ribosomal RNA small subunit methyltransferase I (rsmI) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K07056, (no description) (inferred from 100% identity to psb:Psyr_4112)

Predicted SEED Role

"rRNA small subunit methyltransferase I" in subsystem Heat shock dnaK gene cluster extended

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZNY0 at UniProt or InterPro

Protein Sequence (304 amino acids)

>Psyr_4112 Protein of unknown function UPF0011 (Pseudomonas syringae pv. syringae B728a)
MHFFQVPVLTCEVCVLTVPVVSNSTSGSLYVVATPIGNLDDMSVRALKVLREVALIAAED
TRHSARLMQHFGISTPLAACHEHNERDEGSRFITRLLAGDDVALISDAGTPLISDPGYHL
VRQARAAGVPVVPVPGACALIAALSAAGLPSDRFIFEGFLPAKSAGRKARLERVREEPRT
LIYYEAPHRILECLQDMELVFGADRQALLAREITKTFETLKGLPLGELRAFVESDSNQQR
GECVVLVAGWTPPDDEDVIGDEARRVLDLLLAEMPLKRAAALAAEITGVRKNLLYQVALE
KQKE