Protein Info for Psyr_4108 in Pseudomonas syringae pv. syringae B728a

Annotation: peptidoglycan synthetase FtsI

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 576 signal peptide" amino acids 1 to 31 (31 residues), see Phobius details PF03717: PBP_dimer" amino acids 55 to 204 (150 residues), 71 bits, see alignment E=1.9e-23 PF00905: Transpeptidase" amino acids 245 to 545 (301 residues), 284.7 bits, see alignment E=8.6e-89

Best Hits

Swiss-Prot: 75% identical to FTSI_PSEAE: Peptidoglycan D,D-transpeptidase FtsI (ftsI) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K03587, cell division protein FtsI (penicillin-binding protein 3) [EC: 2.4.1.129] (inferred from 100% identity to psb:Psyr_4108)

Predicted SEED Role

"Cell division protein FtsI [Peptidoglycan synthetase] (EC 2.4.1.129)" in subsystem Bacterial Cell Division or Bacterial Cytoskeleton or Flagellum in Campylobacter or Peptidoglycan Biosynthesis (EC 2.4.1.129)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.4.1.129

Use Curated BLAST to search for 2.4.1.129

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZNY4 at UniProt or InterPro

Protein Sequence (576 amino acids)

>Psyr_4108 peptidoglycan synthetase FtsI (Pseudomonas syringae pv. syringae B728a)
MMKLDGALYPWRFRVVVGLLVSLVLAICWRIVDLQVIDHTFLKEQGDARSLRHIPIPAHR
GLITDRNGEPLAVSTPVTTLWANPREMQQDKSKWPMLAAALGQDLKALTERLDSQANKEF
IYLVRGLTPEQGQSVIDLKVPGVYGIEEFRRFYPAGDVTAHMVGFTDLDDHGREGVELAY
DDWLAGVPGKRQVIKDRRGRLIKDVQVTKNAKAGKTLALSIDLRLQYLATRELRNAIVEN
EAKAGSMVIMDVKTGEVLAMVNQPTYNPNNRRTMVPAAMRNRAIIDVFEPGSTMKPISMT
AALDSGRWKPTDKVEVYPGTLQIGKYTIRDVTKTEGPILDLTGILINSSNVGMSKVAFDV
GGEAIFRAMQRVGFGQYTGLGFPGERVGNLPNYREWRKAETATLSYGYGLSVTALQLVHA
YGALANNGRIVPLTILKTDKEPESTQAIPEKTAKTLQGMLQQVIEDPRGVYRARVPSYHV
GGKSGTARKTSIGTKGYAENSYRSLFAGFGPMSNPRYAIVVVIDEPSKGGYYGGLVSAPV
FSKVMSGTLRLMNVTPDNLAPPEQVNAAPAAKGGRG