Protein Info for Psyr_4107 in Pseudomonas syringae pv. syringae B728a

Annotation: UDP-N-acetylmuramoylalanyl-D-glutamate--2, 6-diaminopimelate ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 487 transmembrane" amino acids 297 to 310 (14 residues), see Phobius details PF01225: Mur_ligase" amino acids 18 to 94 (77 residues), 41.9 bits, see alignment E=1.6e-14 TIGR01085: UDP-N-acetylmuramyl-tripeptide synthetase" amino acids 18 to 479 (462 residues), 513 bits, see alignment E=4.2e-158 PF08245: Mur_ligase_M" amino acids 106 to 306 (201 residues), 185.5 bits, see alignment E=1.8e-58 PF02875: Mur_ligase_C" amino acids 329 to 455 (127 residues), 118.3 bits, see alignment E=6.3e-38

Best Hits

Swiss-Prot: 94% identical to MURE_PSESM: UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase (murE) from Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)

KEGG orthology group: K01928, UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase [EC: 6.3.2.13] (inferred from 100% identity to psb:Psyr_4107)

Predicted SEED Role

"UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase (EC 6.3.2.13)" in subsystem Methicillin resistance in Staphylococci or Peptidoglycan Biosynthesis (EC 6.3.2.13)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.2.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZNY5 at UniProt or InterPro

Protein Sequence (487 amino acids)

>Psyr_4107 UDP-N-acetylmuramoylalanyl-D-glutamate--2, 6-diaminopimelate ligase (Pseudomonas syringae pv. syringae B728a)
MAFNLSKIFAHTDRDALIRELTLDSRNVRPGDLFLAVPGIKVDGRAHIADALKRGAAAVA
YEVAGSTVLPITDVPLIPVKGLAGQLSAIAGRFYGDPSRSLNLVGVTGTNGKTSVTQLVA
QALDVLGQRCGIVGTLGTGFYGSLQSGRHTTPDPIAVQATLTDLRKAGARAVAMEVSSHG
LDQGRATALAFDVAVLTNLSRDHLDYHGTMEAYAAAKAKLFAWSDLKCRVINLDDDFGRE
LAAVKQESRLITYSQLDSSAYLYCRDAKFDDDGVRATLVTPQGEHFLRSSLLGRFNLSNV
LAAVGALLGLDYALDEILKALPKLEGPVGRMQRLGGADKPLVVVDYAHTPDALEKVLEAL
RPHAKGRLLCLFGCGGDRDRGKRPLMAGVVERLADGVWVTDDNPRSESPVSIFDDIRPGF
VAADKVRFIEGRGQAIAELIASANADDVVVLAGKGHEDYQEINGQRQPFSDLQEAASALA
VWEPANA