Protein Info for Psyr_4104 in Pseudomonas syringae pv. syringae B728a

Annotation: UDP-N-acetylmuramoylalanine--D-glutamate ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 448 PF21799: MurD-like_N" amino acids 11 to 97 (87 residues), 95.4 bits, see alignment E=3e-31 TIGR01087: UDP-N-acetylmuramoylalanine--D-glutamate ligase" amino acids 12 to 445 (434 residues), 404.5 bits, see alignment E=3.4e-125 PF08245: Mur_ligase_M" amino acids 114 to 285 (172 residues), 85.3 bits, see alignment E=8.5e-28 PF02875: Mur_ligase_C" amino acids 308 to 424 (117 residues), 57.5 bits, see alignment E=4e-19

Best Hits

Swiss-Prot: 100% identical to MURD_PSEU2: UDP-N-acetylmuramoylalanine--D-glutamate ligase (murD) from Pseudomonas syringae pv. syringae (strain B728a)

KEGG orthology group: K01925, UDP-N-acetylmuramoylalanine--D-glutamate ligase [EC: 6.3.2.9] (inferred from 100% identity to psb:Psyr_4104)

Predicted SEED Role

"UDP-N-acetylmuramoylalanine--D-glutamate ligase (EC 6.3.2.9)" in subsystem Peptidoglycan Biosynthesis (EC 6.3.2.9)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.2.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZNY8 at UniProt or InterPro

Protein Sequence (448 amino acids)

>Psyr_4104 UDP-N-acetylmuramoylalanine--D-glutamate ligase (Pseudomonas syringae pv. syringae B728a)
MSLIVSDRFRIVVGLGKSGMSLVRFLANQGVSFAVADTRENPPELATLRRDYPQVEVRCG
ELDVDFLCRADELYVSPGLALATPALQQAHARGVKLSGDIELFARYAKAPVIAITGSNAK
STVTTLVGEMAAAAGKRVAVGGNLGTPALDLLSDEVELYVMELSSFQLETTDQLNAEVAT
VLNISEDHMDRYSGLPAYHLAKHRIFRGARQVVVNGQDALSRPLIGEGLPCWTFGLNKPD
FHGFGLREENGEKYLAFQFENLMPVRELKVRGAHNQANALAALALGHAVGLPFDAMLASL
REFTGLEHRCQWLREHDGVHYYNDSKATNVGAALAAIEGLGSDIDGKLVLIAGGDGKGAD
FSGLRAPVARHCRAAVLLGRDAELIAQALGDAVPLLRVDTVQAAVEHSAKLAQCGDAVLL
SPACASLDMFKNYEERGRVFAQAVECLS