Protein Info for Psyr_4102 in Pseudomonas syringae pv. syringae B728a

Annotation: UDP-N-acetylglucosamine--N-acetylmuramyl- (pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 356 TIGR01133: undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase" amino acids 4 to 349 (346 residues), 358.8 bits, see alignment E=1.5e-111 PF03033: Glyco_transf_28" amino acids 5 to 141 (137 residues), 144.5 bits, see alignment E=3.4e-46 PF13579: Glyco_trans_4_4" amino acids 20 to 144 (125 residues), 30.5 bits, see alignment E=6.7e-11 PF04101: Glyco_tran_28_C" amino acids 182 to 343 (162 residues), 134.4 bits, see alignment E=6.4e-43

Best Hits

Swiss-Prot: 100% identical to MURG_PSEU2: UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase (murG) from Pseudomonas syringae pv. syringae (strain B728a)

KEGG orthology group: K02563, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [EC: 2.4.1.227] (inferred from 100% identity to psb:Psyr_4102)

MetaCyc: 47% identical to N-acetylglucosaminyl transferase (Escherichia coli K-12 substr. MG1655)
acetylglucosaminyltransferase. [EC: 2.4.1.227]

Predicted SEED Role

"UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase (EC 2.4.1.227)" in subsystem Peptidoglycan Biosynthesis (EC 2.4.1.227)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.1.227

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZNZ0 at UniProt or InterPro

Protein Sequence (356 amino acids)

>Psyr_4102 UDP-N-acetylglucosamine--N-acetylmuramyl- (pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase (Pseudomonas syringae pv. syringae B728a)
MDANVLIMAGGTGGHVFPALACAREFQARGYKVHWLGTPRGIENELVPQAGLTLHLINVT
GLRGKGRLSLLKAPLMLLKALMQARKVVRQVKPVCVVGFGGYVTGPGGLAAKLAGVPLII
HEQNAVAGTANRSLASFASRVCEAFPNTFADSSKRRTTGNPVRVELFLETPRQALAGRKA
RLLVLGGSLGAEPLNKLLPEALSQLPQDIQPEVFHQSGKNHDAVTAERYRNVGVEAQVAP
FIQNMAQAYGWADLVVCRAGALTISELAAAGLPSLLIPLPHAIDDHQSRNADYLAREGAA
FVMPQATTGAAEMAARLKEVLMQPEQLNSMARTARSLAKPDATRTVVNVCVEVAHG