Protein Info for Psyr_4100 in Pseudomonas syringae pv. syringae B728a

Annotation: D-alanine--D-alanine ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01205: D-alanine--D-alanine ligase
  • amino acids 20 to 313 (294 residues), 351.1 bits, E=2.4e-109
• PF01820: Dala_Dala_lig_N
  • amino acids 68 to 102 (35 residues), 44.8 bits, 4.3e-15
• PF02786: CPSase_L_D2
  • amino acids 115 to 195 (81 residues), 23.1 bits, E=1.2e-08
• PF07478: Dala_Dala_lig_C
  • amino acids 120 to 311 (192 residues), 189.2 bits, E=1.6e-59
• PF02222: ATP-grasp
  • amino acids 121 to 280 (160 residues), 27.7 bits, E=4.9e-10
• PF13535: ATP-grasp_4
  • amino acids 147 to 282 (136 residues), 29.6 bits, E=1.2e-10

Best Hits

Swiss-Prot: 96% identical to DDLB_PSESM: D-alanine--D-alanine ligase B (ddlB) from Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)

KEGG orthology group: K01921, D-alanine-D-alanine ligase [EC: 6.3.2.4] (inferred from 100% identity to psb:Psyr_4100)

Predicted SEED Role

"D-alanine--D-alanine ligase (EC 6.3.2.4)" in subsystem Peptidoglycan Biosynthesis (EC 6.3.2.4)

MetaCyc Pathways

• peptidoglycan biosynthesis I (meso-diaminopimelate containing) (12/12 steps found)
• UDP-N-acetylmuramoyl-pentapeptide biosynthesis I (meso-diaminopimelate containing) (8/8 steps found)
• UDP-N-acetylmuramoyl-pentapeptide biosynthesis II (lysine-containing) (7/8 steps found)
• UDP-N-acetylmuramoyl-pentapeptide biosynthesis III (meso-diaminopimelate containing) (6/8 steps found)
• peptidoglycan biosynthesis III (mycobacteria) (11/15 steps found)
• peptidoglycan biosynthesis II (staphylococci) (12/17 steps found)
• peptidoglycan biosynthesis IV (Enterococcus faecium) (12/17 steps found)
• peptidoglycan biosynthesis V (β-lactam resistance) (11/17 steps found)

KEGG Metabolic Maps

• D-Alanine metabolism
• Peptidoglycan biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 6.3.2.4

Use Curated BLAST to search for 6.3.2.4

Sequence Analysis Tools

See Q4ZNZ2 at UniProt or InterPro

Protein Sequence (319 amino acids)

>Psyr_4100 D-alanine--D-alanine ligase (Pseudomonas syringae pv. syringae B728a)
MTAVAQSSLRSTLEPKSFGRVAVLFGGKSAERAVSLNSGNAVLGALLEAGVDAFGIDVGD
DFLQRLVSEKIDRAFIVLHGRGGEDGTMQGLLECLEIPYTGSGVLASALAMDKLRTKQVW
QSLGLATPAHAVLENESDCICAATELGLPLIVKPAHEGSSIGMAKVNSVDELIAAWKAAS
TYDSQVLVEQWIQGPEFTVASLRGQVLPPIGLGTPHSFYDYDAKYLASDTQYRIPCGLGD
AQEQELKQLAARACDAIGIAGWARTDVMQDAQGKFWLLEVNTVPGMTDHSLVPMAARAAG
LDFQQLVLAILADSVQARG