Protein Info for Psyr_4099 in Pseudomonas syringae pv. syringae B728a

Annotation: Cell division protein FtsQ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 289 transmembrane" amino acids 47 to 64 (18 residues), see Phobius details PF08478: POTRA_1" amino acids 74 to 142 (69 residues), 68.7 bits, see alignment E=4.4e-23 PF03799: FtsQ_DivIB_C" amino acids 146 to 264 (119 residues), 73.3 bits, see alignment E=2.9e-24

Best Hits

Swiss-Prot: 73% identical to FTSQ_PSEAE: Cell division protein FtsQ (ftsQ) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K03589, cell division protein FtsQ (inferred from 100% identity to psb:Psyr_4099)

Predicted SEED Role

"Cell division protein FtsQ" in subsystem Bacterial Cell Division or Bacterial Cytoskeleton

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZNZ3 at UniProt or InterPro

Protein Sequence (289 amino acids)

>Psyr_4099 Cell division protein FtsQ (Pseudomonas syringae pv. syringae B728a)
MYGPSTRPQPPASGRNKPVPRGASRMVAKEPLSARLPKANFSFLKRLLWPVLLVVLGFGT
YEAAQRLLPYADRPITRINVQGDLSYISQQAVQQRIAPYVASSFFKIDLAAMRTELEQMP
WIAHAEVRRVWPDQVVIRLEEQLPVARWGDEALLNNQGQAFTPRELSNYEHLPQLFGPQR
AQQQVMQQYQVLSQMLRPLGFSIVRLELRERGSWFLTTGAGSAGPGIELLLGRDHLVEKM
RRFIAIYDKTLKDQITNIARVDLRYSNGLAVGWREQAAPATEKPAVAKN