Protein Info for Psyr_4089 in Pseudomonas syringae pv. syringae B728a

Annotation: PAS

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 678 transmembrane" amino acids 16 to 42 (27 residues), see Phobius details amino acids 156 to 179 (24 residues), see Phobius details PF00672: HAMP" amino acids 183 to 234 (52 residues), 32.7 bits, see alignment 1.8e-11 TIGR00229: PAS domain S-box protein" amino acids 288 to 403 (116 residues), 32.1 bits, see alignment E=5.3e-12 PF00989: PAS" amino acids 289 to 394 (106 residues), 39.1 bits, see alignment E=1.7e-13 PF08448: PAS_4" amino acids 294 to 397 (104 residues), 35.6 bits, see alignment E=2.4e-12 PF00512: HisKA" amino acids 415 to 501 (87 residues), 30.5 bits, see alignment E=7.5e-11 PF02518: HATPase_c" amino acids 553 to 663 (111 residues), 82 bits, see alignment E=1e-26

Best Hits

KEGG orthology group: None (inferred from 100% identity to psb:Psyr_4089)

Predicted SEED Role

"Sensory box histidine kinase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZP03 at UniProt or InterPro

Protein Sequence (678 amino acids)

>Psyr_4089 PAS (Pseudomonas syringae pv. syringae B728a)
MPLRQRLENLPVGQKLLAALLVLMTTVLLVANLTFISAAYYISQEAMAPQALQTIGRLIS
SANLNERALYSPDEARALLKELRSYGPLRAAALYDNNGERLEQMHQGESLELPRRFKDLD
SWRLTEFRSTQVITVPKGDEPPGHLLLVASSELPPAFYTGTLTASLGILVFSVLLWLVVA
RQIRRLITEPIYQLEELSRQVTREENYALRAEPGNDDEIGSLAEAFNTMLSRIEAREQQL
KRARDDSQEAYDQAQGLAEETRHTNRKLELEVQVRSKIEKKLTGFQNYLNSIIDSMPSAM
IALDEQLYVTQWNQEATALSGTTLDEALNQPIFLAFEPMRSFLPQIKHTVERHSVTKIER
VTWIKNDEPRHYALTFYPLTGDAGRGVVIRIDDITQRISLEEMMVQSEKMLSVGGLAAGM
AHEINNPLGAILHNVQNIRRRLSPELPKNIEQAEADGIDLAQVNHYLESREVPKLLDGIQ
QAGARAAKIVSHMLNFSRLSSRQLSPCDLPALIDQAVEIASNDFDLTIGFDFKGQHIIRQ
FDPELGPVPCIANELEQVLLNLLKNAAQAIHQRPESEEPGRITLRTRLNPPWAEIQVEDN
GIGMSESIRKRTFEPFFTTKEIGQGTGLGLSVSYFIVTNNHKGQMEVHSSLGTGTCFTLR
LPLVANPVSVQQQVISKS