Protein Info for Psyr_4087 in Pseudomonas syringae pv. syringae B728a

Annotation: Protein of unknown function DUF520

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 159 PF04461: YajQ" amino acids 2 to 158 (157 residues), 204.2 bits, see alignment E=7.1e-65

Best Hits

Swiss-Prot: 100% identical to Y4087_PSEU2: UPF0234 protein Psyr_4087 (Psyr_4087) from Pseudomonas syringae pv. syringae (strain B728a)

KEGG orthology group: K09767, hypothetical protein (inferred from 96% identity to pst:PSPTO_4393)

Predicted SEED Role

"FIG001943: hypothetical protein YajQ"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZP05 at UniProt or InterPro

Protein Sequence (159 amino acids)

>Psyr_4087 Protein of unknown function DUF520 (Pseudomonas syringae pv. syringae B728a)
MPSFDVVSELDKHEVTNAVDNAIKELDRRYDLKGKGTFEFKELTVTLTAEADFQLEAMIE
ILKLALVKRKIDAKCLEIKDAYASGKLMKQEVILREGIDKELAKKIVAHIKEAKLKVQAA
IQGEQVRVTGKKRDDLQEAIAALRAYDSGMPLQFNNFRD