Protein Info for Psyr_3967 in Pseudomonas syringae pv. syringae B728a

Annotation: membrane protein TctB, putative

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 152 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details transmembrane" amino acids 38 to 56 (19 residues), see Phobius details amino acids 76 to 104 (29 residues), see Phobius details amino acids 116 to 134 (19 residues), see Phobius details PF07331: TctB" amino acids 7 to 143 (137 residues), 80.4 bits, see alignment E=7.6e-27

Best Hits

KEGG orthology group: K07794, putative tricarboxylic transport membrane protein (inferred from 100% identity to psb:Psyr_3967)

Predicted SEED Role

"Tricarboxylate transport protein TctB"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZPC5 at UniProt or InterPro

Protein Sequence (152 amino acids)

>Psyr_3967 membrane protein TctB, putative (Pseudomonas syringae pv. syringae B728a)
MVIQRIFAGVLLLACIGLALMAWPYQAPFSYEPVGPRAFPLLMLGLMGVALLYLLIRPTP
IVHTEEDPELDRETLIKIGVCIVLLLVFAGLFEPLGFILSSILIGIPMARLYGGRWLPSV
VVVILMSVGLYLLFDKAMDVPLPLGLLSVLEN