Protein Info for Psyr_3966 in Pseudomonas syringae pv. syringae B728a

Annotation: Uncharacterized protein UPF0065

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 325 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF03401: TctC" amino acids 56 to 322 (267 residues), 77.3 bits, see alignment E=5.6e-26

Best Hits

KEGG orthology group: K07795, putative tricarboxylic transport membrane protein (inferred from 100% identity to psb:Psyr_3966)

Predicted SEED Role

"Tricarboxylate transport protein TctC"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZPC6 at UniProt or InterPro

Protein Sequence (325 amino acids)

>Psyr_3966 Uncharacterized protein UPF0065 (Pseudomonas syringae pv. syringae B728a)
MKFSLRHIAATAGCMLIASQLLAEPKRPECIAPASPGGGFDLTCKLVQSALINEKILNSP
MRVTYMPGGVGAVAYNAVVAQRPADAGTLVAWSSGSLLNLAQGKFGRFDENAVRWLAAVG
TSYGAIAVKSDSPYKNLDDLVQALKADPSKVVIGSGGTVGSQDWMQTALIAKAAGINPRA
LRYVALEGGGEIATALLGGHIQVGSTDISDSMPHILSGDMRLLAVFAEKRIDEPEMKDIP
TAKEQGYDIVWPVVRGFYLGPKVSDEDYNWWKASFDKILASEDFAKLRDQRELFPFAMSG
AELDTYVKKQVADYKVMAKEFGLIQ