Protein Info for Psyr_3964 in Pseudomonas syringae pv. syringae B728a

Annotation: ATP-binding region, ATPase-like:Histidine kinase, HAMP region:Histidine kinase A, N-terminal

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 460 signal peptide" amino acids 6 to 11 (6 residues), see Phobius details transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 171 to 193 (23 residues), see Phobius details PF08521: 2CSK_N" amino acids 18 to 166 (149 residues), 143 bits, see alignment E=1.3e-45 PF00672: HAMP" amino acids 190 to 238 (49 residues), 23.5 bits, see alignment 1.1e-08 PF00512: HisKA" amino acids 244 to 308 (65 residues), 54.7 bits, see alignment E=1.7e-18 PF02518: HATPase_c" amino acids 357 to 457 (101 residues), 80.5 bits, see alignment E=2.6e-26

Best Hits

KEGG orthology group: K07649, two-component system, OmpR family, sensor histidine kinase TctE [EC: 2.7.13.3] (inferred from 100% identity to psb:Psyr_3964)

Predicted SEED Role

"Tricarboxylate transport sensor protein TctE"

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3

Use Curated BLAST to search for 2.7.13.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZPC8 at UniProt or InterPro

Protein Sequence (460 amino acids)

>Psyr_3964 ATP-binding region, ATPase-like:Histidine kinase, HAMP region:Histidine kinase A, N-terminal (Pseudomonas syringae pv. syringae B728a)
MINDSLRWRLLWNLALLLVVLMLASGMSAYWNGREVADTAYDRTLLASARTIAAGLTQRD
GTLSADIPYVALDTFAYDSEGRIYYQVNDIHQKLISGYENLPSPPPGTLRTDDYPALAKF
YNGTYQGQDVRVVSLLKPVTDPGMNGTAEIRVAETQEARKGMARSLMADTLLRLGMLGGG
ALLLVWFTVSAALRPLERLRTAVEERQPDDLRALPMVEVQHELRPLVGALNHFTERLRVQ
FERQAQFIADAAHELRTPLAALKARVELGLRERDPQHWRSTLESAALGTDRLTHLANQLL
SLARIENGARAIAEGGAQQLDLSQLARELGMAMAPLAHSRGVALALEADEPVWLRGEPTL
LNELLSNLIDNALAHTSPGGNVVLRVYAPGVLEVEDDGPGIPPDERERVFERFYRRSQQG
SGAGLGLAIVGEICRAHLARITLHEGAERGLKVRVSFSAT